PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G114100.1
Common NamePHAVU_005G114100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 76aa    MW: 8334.21 Da    PI: 9.6916
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G114100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.54.8e-112667245
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                          ++++E+ l+ +  k+ G++ W++Ia +++ gRt++++  +w 
  Phvul.005G114100.1 26 VEFSEDEETLITRMYKLVGKR-WSLIAGRIP-GRTAEEIEKYWT 67
                        679******************.*********.***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1262074IPR017930Myb domain
SMARTSM007178.1E-102472IPR001005SANT/Myb domain
SuperFamilySSF466899.36E-102570IPR009057Homeodomain-like
PfamPF002491.2E-92667IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-142770IPR009057Homeodomain-like
CDDcd001671.59E-72770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MADSNTSSTQ TSSHSSDSGK RGTSKVEFSE DEETLITRMY KLVGKRWSLI AGRIPGRTAE  60
EIEKYWTSKL SSSSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2381141e-76KP238114.1 Lablab purpureus caprice and triptychon-like enhancer transcript variant X1 (etcl1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149962.14e-47hypothetical protein PHAVU_005G114100g
SwissprotO220592e-19CPC_ARATH; Transcription factor CPC
TrEMBLV7BZ844e-47V7BZ84_PHAVU; Uncharacterized protein
STRINGGLYMA12G32130.35e-38(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.11e-19MYB_related family protein